PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vang0070s00170.1
Common NameLR48_Vigan06g110500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family CO-like
Protein Properties Length: 289aa    MW: 32508.2 Da    PI: 10.4681
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Vang0070s00170.1genomeSNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box279e-091053339
          zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg.......Htv 39
                      +r C+ + +++++++C  ++ +lC+ C ++ H+        H+v
  Vang0070s00170.1 10 ARACDGCIRNRARWYCAADDAFLCQACDSSVHSAnplarrhHRV 53
                      578*****************************668888886655 PP

2CCT65.12e-22231274144
               CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                       Rea++lRY+eKr++R+F+Kk+rYe+RK +Ae+RpR+KGrFvk++
  Vang0070s00170.1 231 REARVLRYREKRRKRLFSKKVRYEVRKMNAEKRPRMKGRFVKRS 274
                       9****************************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.6E-9855IPR000315B-box-type zinc finger
PROSITE profilePS5011910.48855IPR000315B-box-type zinc finger
PfamPF006431.4E-61153IPR000315B-box-type zinc finger
CDDcd000211.05E-91155No hitNo description
PfamPF062035.7E-17231273IPR010402CCT domain
PROSITE profilePS5101716.013231273IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 289 aa     Download sequence    Send to blast
MGKTVGAKTA RACDGCIRNR ARWYCAADDA FLCQACDSSV HSANPLARRH HRVRLKIISH  60
INSGNDLSSG MSNIRVPSWH KGFTKKPRTP RHGRHTNKGV KSPFNVVPEV CPQDTISNSR  120
EESTDQLLYR VPATPSSEQG VSMTDERKVV FLGCESAIEI AEFSADLDYE AVISAWTTQK  180
SPWTTGAKPN LGTQQFFWPH FMGTCGVEFC HLRGELGELS GCHSTMGDDG REARVLRYRE  240
KRRKRLFSKK VRYEVRKMNA EKRPRMKGRF VKRSCIATPP TVPLLNRK*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150430.0AP015043.1 Vigna angularis var. angularis DNA, chromosome 10, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014523547.11e-108PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
TrEMBLA0A0L9UTB71e-119A0A0L9UTB7_PHAAN; Uncharacterized protein
TrEMBLA0A0S3T2G11e-119A0A0S3T2G1_PHAAN; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF14733392
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.18e-39B-box type zinc finger protein with CCT domain
Publications ? help Back to Top
  1. Yang K, et al.
    Genome sequencing of adzuki bean (Vigna angularis) provides insight into high starch and low fat accumulation and domestication.
    Proc. Natl. Acad. Sci. U.S.A., 2015. 112(43): p. 13213-8
    [PMID:26460024]